Skip to main content

Table 3 SOX11-specific peptide used for immunization

From: Expanded clinical and experimental use of SOX11 - using a monoclonal antibody

Antigen Alias Sequence1
SOX11 p-SOX11c-term EDDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVSTSSS
  1. 1Sequence was originally derived from the HPR project as previously described [35].