Skip to main content

Table 1 MRM transition chart for the identification of putative protein biomarkers.

From: MRM screening/biomarker discovery with linear ion trap MS: a library of human cancer-specific peptides

Protein/Peptides z -10lg(p) Spectral count MRM range (min) Transitions (MH+ → product ions)
O43399|TPD54_Human Tumor Protein D54
GLLSDSMTDVPVDTGVAAR 2 91 2 40-90 952.47→(885.3, 1019.2, 1200.3, 1099.2, 574.3)
VVGDRENGSDNLPSSAGSGDKPLSDPAPF (no ID) 3 136 15 0-240 962.45→(1312.0, 1228.1, 1127.0, 1256.3, 815.9)
LGLSTLGELKQNLSR (no ID) 2 114 5 0-240 814.97→(1044.3, 617.3, 745.3, 673.4, 1157.4)
TPAVEGLTEAEEEELRAELTKVEEEIVTLR 3 300 8 145-170 1128.58→(1508.1, 1443.7, 1358.6, 1063.0, 1244.1)
P31947|1433S_Human 14-3-3 protein sigma
LAEQAERYEDMAAFMK 2 112 4 40-90 951.94→(1205.2, 698.1, 1478.2, 795.4, 1625.2)
VLSSIEQKSNEEGSEEKGPEVR (no ID) 3 133 9 0-240 811.06→(740.6, 1110.0, 966.5, 1080.0, 557.2)
P27797|CALR_Human Calreticulin precursor
SGTIFDNFLITNDEAYAEEFGNETWGVTK 3 300 25 125-145 1090.16→(1512.0, 1424.0, 1462.1, 991.2,1289.7)
FYGDEEKDKGLQTSQDAR 2 141 13 0-40 1043.98→(1841.9, 803.6, 975.5, 1112.6, 1104.6)
IDNSQVESGSLEDDWDFLPPKK 3 85 14 0-240 840.40→(981.9, 1146.5, 932.8, 1089.3, 1204.0)
P08195|4F2_Human 4F2 cell-surface antigen heavy chain
ADLLLSTQPGREEGSPLELER 3 84 5 40-90 770.73→(706.2, 893.3, 900.6, 842.4, 1004.3)
IKVAEDEAEAAAAAK 2 94 5 0-240 743.89→(1245.2, 1146.1, 946.1, 831.1, 1075.1)
P07339|CATD_Human Cathepsin D precursor
ISVNNVLPVFDNLMQQK 2 119 22 90-125 980.02→(1219.3, 1332.3, 880.5, 610.1, 724.2)
LVDQNIFSFYLSRDPDAQPGGELMLGGTDSK 3 300 23 0-240 1124.21→(1261.3, 1344.6, 1055.2, 1016.1, 1579.6)
P46013|Ki-67 antigen (no ID)
AQALEDLAGFKELFQTPGHTEELVAAGK (no ID) 3 71 1 0-240 990.84→(1208.4, 1080.1, 604.9, 1386.6, 924.7)
SGGSGHAVAEPASPEQELDQNKGK (no ID) 3 44 1 0-240 798.38→(956.0,870.9, 643,2, 921.0, 653.1)
P12004|PCNA_HUMAN Proliferating cell nuclear antigen (no ID)
ATPLSSTVTLSMSADVPLVVEYK (no ID) 2 106 4 0-240 1204.63→(847.2, 1561.2, 1061.2, 1437.3, 538.1)
FSASGELGNGNIK (no ID) 2 98 7 0-240 647.32→(716.1, 744.2, 546.1, 902.2, 989.2)
LSQTSNVDKEEEAVTIEMNEPVQLTFALR (no ID) 3 101 5 0-240 1097.88→(1559.1, 1551.3, 1393.6, 1467.1, 937.4)
YYLAPKIEDEEGS (no ID) 2 112 8 0-240 757.35→(1003.5, 676.4, 511.2, 1074.5, 1187.6)
DLSHIGDAVVISCAK (no ID) 2 113 4 0-240 764.39→(962.2, 566.1, 606.9, 650.4, 1075.2)
NLAMGVNLTSMSK (no ID) 2 35 5 0-240 683.34→(503.2, 864.1, 1064.1, 1067.3, 936.2)
  1. Peptides or proteins marked with "no ID" were not detectable in the whole protein extract by data dependent MS analysis. Transitions that did not result in peptide identification in the EIC are marked in bold.