Skip to main content

Table 3 Sequence Alignment of CHEK2 Exon 10

From: Identification of a novel CHEK2variant and assessment of its contribution to the risk of breast cancer in French Canadian women

Mosquito VSDFGSSKFLDHTIFMRTICGTPEYVAPEVLESNGQKPYTRQVDVWSLGVVLYTM --256
Fruit Fly VSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTKKVDIWSLGVVLFTC --376
Homo Sapiens ITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC --420
Chimpanzee  
Dog ITDFGQSKILGETSLMRTLCGTPTYLAPEVLNSFGTAGYNRAVDCWSLGVILFIC --421
Mouse ITDFGQSKILGETSLMRTLCGTPTYLAPEVLVSNGTAGYSRAVDCWSLGVILFIC --424
Rat ITDFGQSKILGETSLMRTLCGTPTYLAPEVLISNGTAGYSRAVDCWSLGVILFIC --423
Chicken -TYFGQSKILGETSLMKTLCGTPTYLAPEVLNSFGTAGYSRAVDCWSLGVILFVC --391
Fugu VTDFNQSRILEETMLMRTLCGTPSYLAPEVFTQASTTGYSLAVDAWSLGVLLFVC --396
Tetraodon VTDFNQSRILEETMLMRTLCGTPSYLAPEVFTQASTSGYGLAVDAWSLGVLLFVC --430
C. Elegans LTDFGMAKNSVN--RMKTHCGTPSYCAPEIVANQG-VEYTPKVDIWSLGCVLFIT --370