Skip to main content

Table 1 Peptide sequence

From: Characterization of ductal and lobular breast carcinomas using novel prolactin receptor isoform specific antibodies

LF 259 KGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVD
SF1a 259 KGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVD
SF1b 259 KGYSMVTCIFPPVPGPKIKGFDAHLLEVTP
LF 319 DSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSL
SF1a 319 DSEDQHLMSVHSKEHPSQGDPLMLGASHYKNLKSYRPRKIS
LF 360 LSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCIS
SF1a 360 SQGRLAVFTKATLTTVQ
LF 400 MEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPA
  445 GAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQD
  490 TPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGK
  535 PKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEA
  580 PPSLEONOAEKALANFTATSSKCRLOLGGLDYLDPACFTHSFH
  1. bold indicates unique synthesized sequences